PDB entry 3m3v

View 3m3v on RCSB PDB site
Description: SARS-CoV main protease triple mutant STI/A with two N-terminal additional residue (Gly-Ser)
Class: hydrolase
Keywords: sars protease STI/A mutation, HYDROLASE
Deposited on 2010-03-10, released 2011-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U8 (2-307)
      • engineered mutation (285-287)
    Domains in SCOPe 2.08: d3m3va_
  • Chain 'B':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U8 (2-End)
      • expression tag (1)
      • engineered mutation (285-287)
    Domains in SCOPe 2.08: d3m3vb1, d3m3vb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m3vA (A:)
    gssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedll
    irksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacy
    ngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdle
    gkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkyn
    yepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeftpfdvvr
    qcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3vA (A:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeftpfdvvrqc
    sgvtfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m3vB (B:)
    gssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedll
    irksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacy
    ngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdle
    gkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkyn
    yepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeftpfdvvr
    qcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3vB (B:)
    ssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedlli
    rksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyn
    gspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdleg
    kfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkyny
    epltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeftpfdvvrq
    csgv