PDB entry 3m3s

View 3m3s on RCSB PDB site
Description: Crystal structure of SARS-COV main protease Asn214Ala mutant with authorize N-terminus
Class: hydrolase
Keywords: SARS coronavirus protease N214A mutation, HYDROLASE
Deposited on 2010-03-10, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Gene: main protease
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U8 (0-305)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d3m3sa_
  • Chain 'B':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Gene: main protease
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U8 (0-End)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d3m3sb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m3sA (A:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaaviagdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
    sgvtfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m3sB (B:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaaviagdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
    sgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m3sB (B:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaaviagdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
    sg