PDB entry 3m3q

View 3m3q on RCSB PDB site
Description: Crystal Structure of Agrocybe aegerita lectin AAL complexed with Ganglosides GM1 pentasaccharide
Class: hydrolase
Keywords: galectin, AAL, Ganglosides GM1, Apoptosis, Hydrolase, Lectin, Nuclease
Deposited on 2010-03-09, released 2010-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • expression tag (0)
      • see remark 999 (132)
    Domains in SCOPe 2.06: d3m3qa1, d3m3qa2
  • Chain 'B':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • expression tag (0)
      • see remark 999 (132)
    Domains in SCOPe 2.06: d3m3qb1, d3m3qb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m3qA (A:)
    mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytgla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m3qB (B:)
    mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytgla