PDB entry 3m3o

View 3m3o on RCSB PDB site
Description: Crystal Structure of Agrocybe aegerita lectin AAL mutant R85A complexed with p-Nitrophenyl TF disaccharide
Class: hydrolase
Keywords: galectin, AAL, muitant, Thomsen-Friedenreich antigen, Apoptosis, Hydrolase, Lectin, Nuclease, GAL-BETA-1, 3-GALNAC-ALPHA-O-P-Nitrophenyl
Deposited on 2010-03-09, released 2010-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (0-157)
      • engineered mutation (84)
      • see remark 999 (131)
    Domains in SCOPe 2.06: d3m3oa_
  • Heterogens: NPO, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3m3oA (A:)
qgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllhi
afrlqenviifnsrqpdgpwlveqavsdvanqfagidgkamvtvfdhgdkyqvvinektv
iqytkqisgltsslsynateetsifstvveavtytgla