PDB entry 3m39

View 3m39 on RCSB PDB site
Description: The roles of glutamates and metal ions in a rationally designed nitric oxide reductase based on myoglobin: Fe(II)-I107E FeBMb (Fe(II) binding to FeB site)
Class: oxygen transport
Keywords: Alpha Helix, Heme protein, Metal-binding, NO reductase, OXYGEN TRANSPORT
Deposited on 2010-03-08, released 2010-05-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered (28)
      • engineered (42)
      • engineered (67)
      • engineered (106)
    Domains in SCOPe 2.01: d3m39a_
  • Heterogens: HEM, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3m39A (A:)
vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekhdrfkhlkteaemkased
lkkhgvteltalgailkkkghheaelkplaqshatkhkipikylefeseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg