PDB entry 3m2p

View 3m2p on RCSB PDB site
Description: The crystal structure of UDP-N-acetylglucosamine 4-epimerase from Bacillus cereus
Class: isomerase
Keywords: SGXNY, 11155j, UDP, Isomerase, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2010-03-08, released 2010-04-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.215
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylglucosamine 4-epimerase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_5271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q814Z6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3m2pa_
  • Chain 'B':
    Compound: UDP-N-acetylglucosamine 4-epimerase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_5271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q814Z6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3m2pb_
  • Chain 'C':
    Compound: UDP-N-acetylglucosamine 4-epimerase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_5271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q814Z6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3m2pc_
  • Chain 'D':
    Compound: UDP-N-acetylglucosamine 4-epimerase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_5271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q814Z6 (3-300)
      • expression tag (1-2)
      • expression tag (301-302)
    Domains in SCOPe 2.05: d3m2pd_
  • Chain 'E':
    Compound: UDP-N-acetylglucosamine 4-epimerase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_5271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q814Z6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3m2pe_
  • Chain 'F':
    Compound: UDP-N-acetylglucosamine 4-epimerase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_5271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q814Z6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3m2pf_
  • Heterogens: UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m2pA (A:)
    mslkiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinql
    ndvdavvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslp
    wnekelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrq
    afhgeqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantin
    nafgnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrglddvp
    lwyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m2pA (A:)
    slkiavtggtgflgqyvvesikndgntpiiltrsigdyeyrvsdytledlinqlndvdav
    vhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekel
    plpdlmygvsklacehigniysrkkglciknlrfahlygfnenyminrffrqafhgeqlt
    lhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnafgnkdn
    llvknpnanegihssymdsskakelldfstdynfataveeihllmrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m2pB (B:)
    mslkiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinql
    ndvdavvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslp
    wnekelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrq
    afhgeqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantin
    nafgnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrglddvp
    lwyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m2pB (B:)
    slkiavtggtgflgqyvvesikndgntpiiltrsigyeyrvsdytledlinqlndvdavv
    hlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekelp
    lpdlmygvsklacehigniysrkkglciknlrfahlygfnenyminrfakreflyakdaa
    ksviyalkqekvsgtfnigsgdaltnyevantinnafgnihssymdsskakelldfstdy
    nfataveeihllmrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3m2pC (C:)
    mslkiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinql
    ndvdavvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslp
    wnekelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrq
    afhgeqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantin
    nafgnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrglddvp
    lwyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m2pC (C:)
    slkiavtggtgflgqyvvesikndgntpiiltrsigndyeyrvsdytledlinqlndvda
    vvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwneke
    lplpdlmygvsklacehigniysrkkglciknlrfahlygfnenyminrffrqafhgeql
    tlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnafgnkd
    nllvihssymdsskakelldfstdynfataveeihllmrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m2pD (D:)
    mslkiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinql
    ndvdavvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslp
    wnekelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrq
    afhgeqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantin
    nafgnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrglddvp
    lwyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m2pD (D:)
    slkiavtggtgflgqyvvesikndgntpiiltrsigdyeyrvsdytledlinqlndvdav
    vhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekel
    plpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrqafhgeq
    ltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnafgnk
    dnllvknssymdsskakelldfstdynfataveeihllmrglddvplwy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m2pE (E:)
    mslkiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinql
    ndvdavvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslp
    wnekelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrq
    afhgeqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantin
    nafgnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrglddvp
    lwyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m2pE (E:)
    slkiavtggtgflgqyvvesikndgntpiiltrsigyeyrvsdytledlinqlndvdavv
    hlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekelp
    lpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrqafhakre
    flyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnafgihssymdsskakel
    ldfstdynfataveeihllmrg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m2pF (F:)
    mslkiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinql
    ndvdavvhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslp
    wnekelplpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrq
    afhgeqltlhansvakreflyakdaaksviyalkqekvsgtfnigsgdaltnyevantin
    nafgnkdnllvknpnanegihssymdsskakelldfstdynfataveeihllmrglddvp
    lwyeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m2pF (F:)
    slkiavtggtgflgqyvvesikndgntpiiltrsigdyeyrvsdytledlinqlndvdav
    vhlaatrgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekel
    plpdlmygvsklacehigniysrkkglciknlrfahlygfneknnyminrffrqasvakr
    eflyakdaaksviyalkqekvsgtfnigsgdaltnyevantinnafgnkegihssymdss
    kakelldfstdynfataveeihllmrg