PDB entry 3m2g

View 3m2g on RCSB PDB site
Description: Crystallographic and Single Crystal Spectral Analysis of the Peroxidase Ferryl Intermediate
Class: oxidoreductase
Keywords: Cytochrome c peroxidase (CCP), Oxidoreductase, Heme, Hydrogen peroxide, Iron, Metal-binding, Mitochondrion, Organic radical, Peroxidase
Deposited on 2010-03-07, released 2010-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.116
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP, CCP1, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-290)
      • engineered (180)
    Domains in SCOPe 2.08: d3m2ga_
  • Heterogens: HEM, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m2gA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
    rsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl