PDB entry 3m1y

View 3m1y on RCSB PDB site
Description: Crystal Structure of a Phosphoserine phosphatase (SerB) from Helicobacter pylori
Class: hydrolase
Keywords: NYSGXRC, PSI II, phophoserine phosphatase, Protein structure Initiative, structural genomics, New York SGX Research Center for Structural Genomics, HYDROLASE
Deposited on 2010-03-05, released 2010-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine phosphatase (SerB)
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP_0652
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25367 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3m1ya1, d3m1ya2
  • Chain 'B':
    Compound: Phosphoserine phosphatase (SerB)
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP_0652
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m1yb_
  • Chain 'C':
    Compound: Phosphoserine phosphatase (SerB)
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP_0652
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25367 (3-208)
      • expression tag (1-2)
      • expression tag (209)
    Domains in SCOPe 2.06: d3m1yc1, d3m1yc2, d3m1yc3
  • Chain 'D':
    Compound: Phosphoserine phosphatase (SerB)
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP_0652
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25367 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3m1yd1, d3m1yd2
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m1yA (A:)
    mslqklavfdfdstlvnaetieslarawgvfdevktitlkamngetdfhkslilrvsklk
    nmplklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsn
    tlivendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahik
    iafnakevlkqhathcinepdlalikplieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m1yA (A:)
    slqklavfdfdstlvnaetieslarawgvfdevktitlketdfhkslilrvsklknmplk
    lakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsntlive
    ndalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahikiafna
    kevlkqhathcinepdlalikpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m1yB (B:)
    mslqklavfdfdstlvnaetieslarawgvfdevktitlkamngetdfhkslilrvsklk
    nmplklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsn
    tlivendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahik
    iafnakevlkqhathcinepdlalikplieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m1yB (B:)
    qklavfdfdstlvnaetieslarawgvfdevktitlkamngetdfhkslilrvsklknmp
    lklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsntli
    vendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahikiaf
    nakevlkqhathcinepdlalikpli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3m1yC (C:)
    mslqklavfdfdstlvnaetieslarawgvfdevktitlkamngetdfhkslilrvsklk
    nmplklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsn
    tlivendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahik
    iafnakevlkqhathcinepdlalikplieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m1yC (C:)
    slqklavfdfdstlvnaetieslarawgvfdevktitlkamngtdfhkslilrvsklknm
    plklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsntl
    ivendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahikia
    fnakevlkqhathcinepdlalikplie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m1yD (D:)
    mslqklavfdfdstlvnaetieslarawgvfdevktitlkamngetdfhkslilrvsklk
    nmplklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsn
    tlivendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahik
    iafnakevlkqhathcinepdlalikplieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m1yD (D:)
    slqklavfdfdstlvnaetieslarawgvfdevktitlkamnetdfhkslilrvsklknm
    plklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsntl
    ivendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahikia
    fnakevlkqhathcinepdlalikpl