PDB entry 3m15

View 3m15 on RCSB PDB site
Description: A Zn-mediated asymmetric trimer of a cytochrome cb562 variant (D74A-RIDC1)
Class: electron transport
Keywords: Asymmetric, four-helix bundle, homotrimer, Electron transport, Heme, Metal-binding, Transport
Deposited on 2010-03-04, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m15a_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m15b_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3m15c_
  • Heterogens: HEM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m15A (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m15B (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m15C (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr