PDB entry 3m11

View 3m11 on RCSB PDB site
Description: Crystal Structure of Aurora A Kinase complexed with inhibitor
Class: transferase/transferase inhibitor
Keywords: Aurora kinase inhibitor, X-ray co-crystal analysis, Structure-based drug design, ATP-binding, Cell cycle, Cytoskeleton, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-03-03, released 2011-03-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3m11a_
  • Heterogens: AKI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m11A (A:)
    skkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrev
    eiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelan
    alsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrtdlcgtldylppemie
    grmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisr
    llkhnpsqrpmlrevlehpwitansskpsncqnkesask
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m11A (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhgtldylppemiegrmhdekvdlwsl
    gvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlr
    evlehpwitansskps