PDB entry 3m0w

View 3m0w on RCSB PDB site
Description: Structure of S100A4 with PCP
Class: Calcium Binding Protein
Keywords: MTS1, S100 CALCIUM-BINDING PROTEIN A4, S100A4, METASTASIN, Calcium Binding Protein
Deposited on 2010-03-03, released 2010-05-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.254
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0wa_
  • Chain 'B':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0wb_
  • Chain 'C':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0wc_
  • Chain 'D':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0wd_
  • Chain 'E':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0we_
  • Chain 'F':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0wf_
  • Chain 'G':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0wg_
  • Chain 'H':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0wh_
  • Chain 'I':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0wi_
  • Chain 'J':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3m0wj_
  • Heterogens: P77, CA, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m0wA (A:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wA (A:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m0wB (B:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wB (B:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsfltdeaafqklmsnlds
    nrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3m0wC (C:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wC (C:)
    cplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgdeaafqklmsnldsn
    rdnevdfqeycvflsciammcneffegf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3m0wD (D:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wD (D:)
    cplekaldvmvstfhkysgkegdkfklnkselkelltrelpsfldeaafqklmsnldsnr
    dnevdfqeycvflsciammcneffeg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3m0wE (E:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wE (E:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3m0wF (F:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wF (F:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsfldeaafqklmsnldsn
    rdnevdfqeycvflsciammcneffe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3m0wG (G:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wG (G:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgeaafqklmsnldsn
    rdnevdfqeycvflsciammcneffe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3m0wH (H:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wH (H:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3m0wI (I:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wI (I:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3m0wJ (J:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0wJ (J:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsfltdeaafqklmsnlds
    nrdnevdfqeycvflsciammcneffegf