PDB entry 3m0q

View 3m0q on RCSB PDB site
Description: Crystal Structure of the R21D mutant of alpha-spectrin SH3 domain. Crystal obtained in ammonium sulphate at pH 5.
Class: signaling protein
Keywords: SH3-like barrel, Actin capping, Actin-binding, Calmodulin-binding, Cytoskeleton, Phosphoprotein, SH3 domain, SIGNALING PROTEIN
Deposited on 2010-03-03, released 2011-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Spectrin alpha chain, brain
  Species: Gallus gallus [TaxId:9031]
  Gene: SPTAN1, SPTA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07751 (Start-61)
    • engineered (20)
  Domains in SCOPe 2.06: d3m0qa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3m0qA (A:)
  mdetgkelvlalydyqekspdevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkk
  ld
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3m0qA (A:)
  elvlalydyqekspdevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld