PDB entry 3m0p

View 3m0p on RCSB PDB site
Description: Crystal Structure of the R21D mutant of alpha-spectrin SH3 domain. Crystal obtained in ammonium sulphate at pH 4.
Class: signaling protein
Keywords: SH3-like barrel, Actin capping, Actin-binding, Calmodulin-binding, Cytoskeleton, Phosphoprotein, SH3 domain, SIGNALING PROTEIN
Deposited on 2010-03-03, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Gene: SPTAN1, SPTA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (Start-61)
      • engineered (20)
    Domains in SCOPe 2.07: d3m0pa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m0pA (A:)
    mdetgkelvlalydyqekspdevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0pA (A:)
    elvlalydyqekspdevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld