PDB entry 3m0b

View 3m0b on RCSB PDB site
Description: Ru-Porphyrin Protein Scaffolds for Sensing O2
Class: signaling protein
Keywords: Oxygen sensing molecule, SIGNALING PROTEIN
Deposited on 2010-03-02, released 2010-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-accepting chemotaxis protein
    Species: Thermoanaerobacter tengcongensis [TaxId:119072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3m0ba_
  • Heterogens: RUR, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m0bA (A:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m0bA (A:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfey