PDB entry 3m08

View 3m08 on RCSB PDB site
Description: Wild Type Dihydrofolate Reductase from Staphylococcus aureus with inhibitor RAB1
Class: Oxidoreductase/Oxidoreductase inhibitor
Keywords: folate, dhfr, antimicrobial, antibiotic resistance, NADP, One-carbon metabolism, Oxidoreductase', Oxidoreductase-Oxidoreductase inhibitor complex
Deposited on 2010-03-02, released 2010-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A017 (0-156)
      • expression tag (157-160)
    Domains in SCOPe 2.08: d3m08a1, d3m08a2
  • Heterogens: RAR, NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m08A (A:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirkavpr