PDB entry 3m00

View 3m00 on RCSB PDB site
Description: Crystal Structure of 5-epi-aristolochene synthase M4 mutant complexed with (2-cis,6-trans)-2-fluorofarnesyl diphosphate
Class: lyase
Keywords: plant terpenoid cyclase, 5-epi-aristolochene synthase, lyase, metal-binding domain, (2-cis, 6-trans)-2-fluorofarnesyl diphosphate, Magnesium, Metal-binding
Deposited on 2010-03-02, released 2010-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aristolochene synthase
    Species: Nicotiana tabacum [TaxId:4097]
    Gene: EAS3, EAS4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q40577 (Start-549)
      • engineered (275)
      • engineered (373)
      • engineered (407)
      • engineered (517)
    Domains in SCOPe 2.07: d3m00a1, d3m00a2
  • Heterogens: 2CF, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m00A (A:)
    gsmasaavanyeeeivrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmll
    atgmkladtlnlidtierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhg
    fnispeifskfqdengkfkeslasdvlgllnlyeashvrthaddiledalafstihlesa
    aphlksplreqvthaleqclhkgvprvetrffissiydkeqsknnvllrfakldfnllqm
    lhkqelaqvsrwwkdldfvttlpyardrvvecyfwtlgvyfepqysqarvmlvktismis
    ivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisykaildlykdyekelssagr
    shivchaiermkeivrnynvestwfiegytppvseylsnalatttyyllattsylgmksa
    teqdfewlsknpkileasviicrviddtatyeveksrgqiatgieccmrdygistkeama
    kfqnmaetawkdinegllrptpvstefltpilnlariievtyihnldgythpekvlkphi
    inllvdsiki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m00A (A:)
    vrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlidt
    ierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqden
    gkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvtha
    leqclhkgvprvetrffissiydkeqsknnvllrfakldfnllqmlhkqelaqvsrwwkd
    ldfvttlpyardrvvecyfwtlgvyfepqysqarvmlvktismisivddtfdaygtvkel
    eaytdaiqrwdineidrlpdymkisykaildlykdyekelssagrshivchaiermkeiv
    rnynvestwfiegytppvseylsnalatttyyllattsylgmksateqdfewlsknpkil
    easviicrviddtatyeveksrgqiatgieccmrdygistkeamakfqnmaetawkdine
    gllrptpvstefltpilnlariievtyihnhpekvlkphiinllvdsiki