PDB entry 3lzz

View 3lzz on RCSB PDB site
Description: Crystal structures of Cupin superfamily BbDUF985 from Branchiostoma belcheri tsingtauense in apo and GDP-bound forms
Class: unknown function
Keywords: beta barrel, UNKNOWN FUNCTION
Deposited on 2010-03-02, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Branchiostoma belcheri tsingtauense [TaxId:155462]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lzza_
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Branchiostoma belcheri tsingtauense [TaxId:155462]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lzzb_
  • Heterogens: GDP, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lzzA (A:)
    maatvdtmseevkrlialyeltphpasggwfretyrsdvqveaegfdgkrsvltmiyylm
    qagqpdpfhrvksdetfvhnlggsmkihmihpdgsyscsilgnplehpearhqvvvprrv
    wfaqevdgyclasvlvapgfdfkdfslgkreelikeypqhrdvimrctssdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzzA (A:)
    eevkrlialyeltphpasggwfretyrsdvqveaegfdgkrsvltmiyylmqagqpdpfh
    rvksdetfvhnlggsmkihmihpdgsyscsilgnplehpearhqvvvprrvwfaqevdgy
    clasvlvapgfdfkdfslgkreelikeypqhrdvimrctss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lzzB (B:)
    maatvdtmseevkrlialyeltphpasggwfretyrsdvqveaegfdgkrsvltmiyylm
    qagqpdpfhrvksdetfvhnlggsmkihmihpdgsyscsilgnplehpearhqvvvprrv
    wfaqevdgyclasvlvapgfdfkdfslgkreelikeypqhrdvimrctssdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzzB (B:)
    eevkrlialyeltphpasggwfretyrsdvqveaegfdgkrsvltmiyylmqagqpdpfh
    rvksdetfvhnlggsmkihmihpdgsyscsilgnplehpearhqvvvprrvwfaqevdgy
    clasvlvapgfdfkdfslgkreelikeypqhrdvimrctss