PDB entry 3lzy

View 3lzy on RCSB PDB site
Description: Crystal structure of Endothiapesin in complex with Xenon
Class: hydrolase
Keywords: protein-Xe complex, Hydrolase, B-Secretase, Endothiapepsin, Aspartyl protease, Protease, Zymogen
Deposited on 2010-03-02, released 2011-05-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3lzya_
  • Heterogens: XE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lzyA (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask