PDB entry 3lzv

View 3lzv on RCSB PDB site
Description: Structure of Nelfinavir-resistant HIV-1 protease (D30N/N88D) in complex with Darunavir.
Class: hydrolase
Keywords: HIV-1 protease, resistance, HYDROLASE
Deposited on 2010-03-01, released 2010-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.184
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (29)
      • engineered (87)
    Domains in SCOPe 2.04: d3lzva_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (29)
      • engineered (87)
    Domains in SCOPe 2.04: d3lzvb_
  • Heterogens: 017, PO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lzvA (A:)
    pqitlwkrplvtiriggqlkealldtgadntvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrdlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lzvB (B:)
    pqitlwkrplvtiriggqlkealldtgadntvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrdlltqigctlnf