PDB entry 3lzv
View 3lzv on RCSB PDB site
Description: Structure of Nelfinavir-resistant HIV-1 protease (D30N/N88D) in complex with Darunavir.
Class: hydrolase
Keywords: HIV-1 protease, resistance, HYDROLASE
Deposited on
2010-03-01, released
2010-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated
2010-09-22, with a file datestamp of
2010-09-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.184
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (29)
- engineered (87)
Domains in SCOPe 2.04: d3lzva_ - Chain 'B':
Compound: hiv-1 protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (29)
- engineered (87)
Domains in SCOPe 2.04: d3lzvb_ - Heterogens: 017, PO4, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3lzvA (A:)
pqitlwkrplvtiriggqlkealldtgadntvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrdlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3lzvB (B:)
pqitlwkrplvtiriggqlkealldtgadntvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrdlltqigctlnf