PDB entry 3lzu
View 3lzu on RCSB PDB site
Description: Crystal Structure of a Nelfinavir Resistant HIV-1 CRF01_AE Protease variant (N88S) in Complex with the Protease Inhibitor Darunavir.
Class: hydrolase
Keywords: HIV-1 protease, non-B clades, CRF01_AE, inhibitor resistance, AIDS, Aspartyl protease, HYDROLASE
Deposited on
2010-03-01, released
2010-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated
2010-09-22, with a file datestamp of
2010-09-17.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.198
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot Q9QB59 (0-98)
- engineered (6)
- engineered (87)
Domains in SCOPe 2.04: d3lzua_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot Q9QB59 (0-98)
- engineered (6)
- engineered (87)
Domains in SCOPe 2.04: d3lzub_ - Heterogens: ACT, 017, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3lzuA (A:)
pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
qilieicgkkaigtvlvgptpvniigrsmltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3lzuB (B:)
pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
qilieicgkkaigtvlvgptpvniigrsmltqigctlnf