PDB entry 3lzu

View 3lzu on RCSB PDB site
Description: Crystal Structure of a Nelfinavir Resistant HIV-1 CRF01_AE Protease variant (N88S) in Complex with the Protease Inhibitor Darunavir.
Class: hydrolase
Keywords: HIV-1 protease, non-B clades, CRF01_AE, inhibitor resistance, AIDS, Aspartyl protease, HYDROLASE
Deposited on 2010-03-01, released 2010-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QB59 (0-98)
      • engineered (6)
      • engineered (87)
    Domains in SCOPe 2.04: d3lzua_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QB59 (0-98)
      • engineered (6)
      • engineered (87)
    Domains in SCOPe 2.04: d3lzub_
  • Heterogens: ACT, 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lzuA (A:)
    pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
    qilieicgkkaigtvlvgptpvniigrsmltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lzuB (B:)
    pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
    qilieicgkkaigtvlvgptpvniigrsmltqigctlnf