PDB entry 3lzu

View 3lzu on RCSB PDB site
Description: Crystal Structure of a Nelfinavir Resistant HIV-1 CRF01_AE Protease variant (N88S) in Complex with the Protease Inhibitor Darunavir.
Class: hydrolase
Keywords: HIV-1 protease, non-B clades, CRF01_AE, inhibitor resistance, AIDS, Aspartyl protease, HYDROLASE
Deposited on 2010-03-01, released 2010-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QB59 (0-98)
    • engineered (6)
    • engineered (87)
  Domains in SCOPe 2.08: d3lzua_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QB59 (0-98)
    • engineered (6)
    • engineered (87)
  Domains in SCOPe 2.08: d3lzub_
• Heterogens: ACT, 017, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lzuA (A:)
  pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
  qilieicgkkaigtvlvgptpvniigrsmltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lzuB (B:)
  pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
  qilieicgkkaigtvlvgptpvniigrsmltqigctlnf