PDB entry 3lzs
View 3lzs on RCSB PDB site
Description: Crystal Structure of HIV-1 CRF01_AE Protease in Complex with Darunavir
Class: hydrolase
Keywords: HIV-1 protease, non-B clades, CRF01_AE, inhibitor resistance, AIDS, Aspartyl protease, HYDROLASE
Deposited on
2010-03-01, released
2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-11-08, with a file datestamp of
2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3lzsa_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3lzsb_ - Heterogens: 017, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3lzsA (A:)
pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
qilieicgkkaigtvlvgptpvniigrnmltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3lzsB (B:)
pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
qilieicgkkaigtvlvgptpvniigrnmltqigctlnf