PDB entry 3lzo

View 3lzo on RCSB PDB site
Description: Crystal Structure Analysis of the copper-reconstituted P19 protein from Campylobacter jejuni at 1.65 A at pH 10.0
Class: transport protein
Keywords: copper binding, iron transport, iron uptake, P19 delition, TRANSPORT PROTEIN
Deposited on 2010-03-01, released 2010-07-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.141
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: P19 protein
    Species: Campylobacter jejuni [TaxId:354242]
    Gene: CJJ81176_1650, Gene Cj81176_1659
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1W1R1 (1-158)
      • expression tag (0)
    Domains in SCOPe 2.08: d3lzoa1, d3lzoa2
  • Chain 'B':
    Compound: P19 protein
    Species: Campylobacter jejuni [TaxId:354242]
    Gene: CJJ81176_1650, Gene Cj81176_1659
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1W1R1 (1-158)
      • expression tag (0)
    Domains in SCOPe 2.08: d3lzob1, d3lzob2
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lzoA (A:)
ggevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpeg
fwmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfy
isnpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lzoB (B:)
ggevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpeg
fwmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfy
isnpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk