PDB entry 3lzg

View 3lzg on RCSB PDB site
Description: Crystal structure of a 2009 H1N1 influenza virus hemagglutinin
Class: viral protein/immune system
Keywords: viral envelope protein, hemagglutinin, viral fusion protein, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2010-03-01, released 2010-04-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin, HA1 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzga_
  • Chain 'B':
    Compound: Hemagglutinin, HA2 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-173)
      • expression tag (174)
    Domains in SCOPe 2.05: d3lzgb_
  • Chain 'C':
    Compound: Hemagglutinin, HA1 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzgc_
  • Chain 'D':
    Compound: Hemagglutinin, HA2 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzgd_
  • Chain 'E':
    Compound: Hemagglutinin, HA1 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzge_
  • Chain 'F':
    Compound: Hemagglutinin, HA2 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzgf_
  • Chain 'G':
    Compound: Hemagglutinin, HA1 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzgg_
  • Chain 'H':
    Compound: Hemagglutinin, HA2 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzgh_
  • Chain 'I':
    Compound: Hemagglutinin, HA1 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzgi_
  • Chain 'J':
    Compound: Hemagglutinin, HA2 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzgj_
  • Chain 'K':
    Compound: Hemagglutinin, HA1 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d3lzgk_
  • Chain 'L':
    Compound: Hemagglutinin, HA2 SUBUNIT
    Species: Influenza A virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lzgl_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lzgA (A:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgA (A:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lzgB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeids
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lzgC (C:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgC (C:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnips
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lzgD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3lzgE (E:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgE (E:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnips
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3lzgF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3lzgG (G:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgG (G:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnips
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3lzgH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3lzgI (I:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgI (I:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnips
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3lzgJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3lzgK (K:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgK (K:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnips
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3lzgL (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzgL (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree