PDB entry 3lzf

View 3lzf on RCSB PDB site
Description: Crystal Structure of Fab 2D1 in Complex with the 1918 Influenza Virus Hemagglutinin
Class: viral protein/immune system
Keywords: hemagglutinin, Fab, neutralizing antibodies, antibody, pandemic flu, swine flu, Envelope protein, Fusion protein, Glycoprotein, antigen, Virion, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2010-03-01, released 2010-04-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.232
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin, HA1 SUBUNIT
    Species: Influenza A virus [TaxId:59375]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3lzfa_
  • Chain 'B':
    Compound: Hemagglutinin, HA2 SUBUNIT
    Species: Influenza A virus [TaxId:59375]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3lzfb_
  • Chain 'H':
    Compound: 2D1 Fab, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin, Gamma Chain
    Database cross-references and differences (RAF-indexed):
    • PDB 3LZF
  • Chain 'L':
    Compound: 2D1 Fab, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: Immunoglobulin, Lambda Chain
    Database cross-references and differences (RAF-indexed):
    • PDB 3LZF
    Domains in SCOPe 2.04: d3lzfl1, d3lzfl2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lzfA (A:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzfA (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
    hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
    tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvrstklrmatglrnips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lzfB (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidgvsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzfB (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreei
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3lzfL (L:)
    qpvltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvp
    drfsgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lzfL (L:)
    pvltqppsasgtpgqrvtiscsgsssnigsntvswyqqvpgtapklliygnnerpsgvpd
    rfsgsksatsaslaisglqsedeadyycaawddslngfwvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvap