PDB entry 3lz7

View 3lz7 on RCSB PDB site
Description: Crystal Structure of thioesterase HI1161 EC3.1.2.- from Haemophilus influenzae. Orthorombic crystal form. Northeast Structural Genomics Consortium Target IR63
Class: hydrolase
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, thioesterase, Hydrolase
Deposited on 2010-03-01, released 2010-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.172
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative esterase HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1161
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-137)
      • expression tag (138-142)
    Domains in SCOPe 2.06: d3lz7a1, d3lz7a2
  • Chain 'B':
    Compound: Putative esterase HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1161
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-137)
      • expression tag (138-139)
    Domains in SCOPe 2.06: d3lz7b1, d3lz7b2
  • Chain 'C':
    Compound: Putative esterase HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1161
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-137)
      • expression tag (138-142)
    Domains in SCOPe 2.06: d3lz7c1, d3lz7c2
  • Chain 'D':
    Compound: Putative esterase HI1161
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1161
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45083 (0-137)
      • expression tag (138-140)
    Domains in SCOPe 2.06: d3lz7d1, d3lz7d2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lz7A (A:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lz7A (A:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lz7B (B:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lz7B (B:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinlle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lz7C (C:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lz7C (C:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lz7D (D:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lz7D (D:)
    mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
    laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
    eenklccvsrltlsvinlleh