PDB entry 3lz6

View 3lz6 on RCSB PDB site
Description: Guinea Pig 11beta hydroxysteroid dehydrogenase with PF-877423
Class: Oxidoreductase/Oxidoreductase inhibitor
Keywords: Oxidoreductase-Oxidoreductase inhibitor COMPLEX
Deposited on 2010-03-01, released 2011-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.209
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3lz6a_
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3lz6b_
  • Chain 'C':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3lz6c_
  • Chain 'D':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3lz6d_
  • Heterogens: NAP, A0D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lz6A (A:)
    kfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaas
    ahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnfh
    sfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvnk
    vnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwvp
    yllgnpgrkimeflsaaeynwdn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lz6B (B:)
    kfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaas
    ahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnfh
    sfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvnk
    vnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwvp
    yllgnpgrkimeflsaaeynwdn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lz6C (C:)
    kfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaas
    ahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnfh
    sfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvnk
    vnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwvp
    yllgnpgrkimeflsaaeynwdn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lz6D (D:)
    kfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaas
    ahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnfh
    sfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvnk
    vnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwvp
    yllgnpgrkimeflsaaeynwdn