PDB entry 3lz2

View 3lz2 on RCSB PDB site
Description: structure determination of turkey egg white lysozyme using laue diffraction
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1991-09-13, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: turkey egg white lysozyme
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3lz2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lz2A (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl