PDB entry 3lyl

View 3lyl on RCSB PDB site
Description: Structure of 3-oxoacyl-acylcarrier protein reductase, FabG from Francisella tularensis
Class: oxidoreductase
Keywords: alpha and beta protein, NAD(P)-binding Rossmann fold, CSGID, Oxidoreductase, Structural Genomics, Center for Structural Genomics of Infectious Diseases (CSGID)
Deposited on 2010-02-27, released 2010-03-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: fabG, FTT1375, FTT_1375
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3lyla_
  • Chain 'B':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: fabG, FTT1375, FTT_1375
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3lylb_
  • Chain 'C':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: fabG, FTT1375, FTT_1375
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3lylc_
  • Chain 'D':
    Compound: 3-oxoacyl-(acyl-carrier-protein) reductase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: fabG, FTT1375, FTT_1375
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3lyld_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lylA (A:)
    mslnekvalvtgasrgigfevahalaskgatvvgtatsqasaekfensmkekgfkarglv
    lnisdiesiqnffaeikaenlaidilvnnagitrdnlmmrmsedewqsvintnlssifrm
    skecvrgmmkkrwgriisigsvvgsagnpgqtnycaakagvigfskslayevasrnitvn
    vvapgfiatdmtdkltdeqksfiatkipsgqigepkdiaaavaflaseeakyitgqtlhv
    nggmyma
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lylB (B:)
    mslnekvalvtgasrgigfevahalaskgatvvgtatsqasaekfensmkekgfkarglv
    lnisdiesiqnffaeikaenlaidilvnnagitrdnlmmrmsedewqsvintnlssifrm
    skecvrgmmkkrwgriisigsvvgsagnpgqtnycaakagvigfskslayevasrnitvn
    vvapgfiatdmtdkltdeqksfiatkipsgqigepkdiaaavaflaseeakyitgqtlhv
    nggmyma
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lylB (B:)
    mslnekvalvtgasrgigfevahalaskgatvvgtatsqasaekfensmkekgfkarglv
    lnisdiesiqnffaeikaenlaidilvnnagitrdnlmmrmsedewqsvintnlssifrm
    skecvrgmmkkrwgriisigsvvgsagnpgqtnycaakagvigfskslayevasrnitvn
    vvapgfiatkltdeqksfiatkipsgqigepkdiaaavaflaseeakyitgqtlhvnggm
    yma
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lylC (C:)
    mslnekvalvtgasrgigfevahalaskgatvvgtatsqasaekfensmkekgfkarglv
    lnisdiesiqnffaeikaenlaidilvnnagitrdnlmmrmsedewqsvintnlssifrm
    skecvrgmmkkrwgriisigsvvgsagnpgqtnycaakagvigfskslayevasrnitvn
    vvapgfiatdmtdkltdeqksfiatkipsgqigepkdiaaavaflaseeakyitgqtlhv
    nggmyma
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lylD (D:)
    mslnekvalvtgasrgigfevahalaskgatvvgtatsqasaekfensmkekgfkarglv
    lnisdiesiqnffaeikaenlaidilvnnagitrdnlmmrmsedewqsvintnlssifrm
    skecvrgmmkkrwgriisigsvvgsagnpgqtnycaakagvigfskslayevasrnitvn
    vvapgfiatdmtdkltdeqksfiatkipsgqigepkdiaaavaflaseeakyitgqtlhv
    nggmyma
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lylD (D:)
    mslnekvalvtgasrgigfevahalaskgatvvgtatsqasaekfensmkekgfkarglv
    lnisdiesiqnffaeikaenlaidilvnnagitrdnlmmrmsedewqsvintnlssifrm
    skecvrgmmkkrwgriisigsvvgsagnpgqtnycaakagvigfskslayevasrnitvn
    vvapgfiatdeqksfiatkipsgqigepkdiaaavaflaseeakyitgqtlhvnggmyma