PDB entry 3lyj

View 3lyj on RCSB PDB site
Description: Crystal structure of the hemagglutinin of 2009 H1N1 influenza virus
Class: Viral Protein/Viral Protein
Keywords: Trimer, Envelope protein, Hemagglutinin, Viral Protein-Viral Protein complex
Deposited on 2010-02-27, released 2010-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.247
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyja_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyjb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyjc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyjd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyje_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyjf_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyjg_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyjh_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyji_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyjj_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyjk_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lyjl_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lyjA (A:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjA (A:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lyjB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lyjC (C:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjC (C:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lyjD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3lyjE (E:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjE (E:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3lyjF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjF (F:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3lyjG (G:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjG (G:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3lyjH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3lyjI (I:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjI (I:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3lyjJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3lyjK (K:)
    adlgsrdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgk
    cniagwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferf
    eifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevl
    vlwgihhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlv
    epgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqn
    ihpitigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjK (K:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3lyjL (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lyjL (L:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky