PDB entry 3ly5

View 3ly5 on RCSB PDB site
Description: DDX18 dead-domain
Class: hydrolase
Keywords: alpha-beta, Structural Genomics, Structural Genomics Consortium, SGC, ATP-binding, Helicase, Hydrolase, Nucleotide-binding, RNA-binding
Deposited on 2010-02-26, released 2010-05-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.247
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DDX18
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ly5a_
  • Chain 'B':
    Compound: ATP-dependent RNA helicase DDX18
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ly5b_
  • Heterogens: PO4, MG, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ly5A (A:)
    mhhhhhhssgvdlgtenlyfqsmnnvekpdndedesevpslplgltgafedtsfaslcnl
    vnentlkaikemgftnmteiqhksirpllegrdllaaaktgsgktlaflipavelivklr
    fmprngtgvlilsptrelamqtfgvlkelmthhvhtyglimggsnrsaeaqklgnginii
    vatpgrlldhmqntpgfmyknlqclvideadrildvgfeeelkqiikllptrrqtmlfsa
    tqtrkvedlarislkkeplyvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly5A (A:)
    tgafedtsflvnentlkaikemgftnmteiqhksirpllegrdllaaaktgsgktlafli
    pavelivklrfmprngtgvlilsptrelamqtfgvlkelmthhvhtyglimggsnrsaea
    qklgnginiivatpgrlldhmqntpgfmyknlqclvideadrildvgfeeelkqiikllp
    trrqtmlfsatqtrkvedlarislkkeplyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ly5B (B:)
    mhhhhhhssgvdlgtenlyfqsmnnvekpdndedesevpslplgltgafedtsfaslcnl
    vnentlkaikemgftnmteiqhksirpllegrdllaaaktgsgktlaflipavelivklr
    fmprngtgvlilsptrelamqtfgvlkelmthhvhtyglimggsnrsaeaqklgnginii
    vatpgrlldhmqntpgfmyknlqclvideadrildvgfeeelkqiikllptrrqtmlfsa
    tqtrkvedlarislkkeplyvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly5B (B:)
    gltgafedtsflvnentlkaikemgftnmteiqhksirpllegrdllaaaktgsgktlaf
    lipavelivklrfmprngtgvlilsptrelamqtfgvlkelmthhvhtyglimggsnrsa
    eaqklgnginiivatpgrlldhmqntpgfmyknlqclvideadrildvgfeeelkqiikl
    lptrrqtmlfsatqtrkvedlarislkkeplyv