PDB entry 3ly2

View 3ly2 on RCSB PDB site
Description: Catalytic Domain of Human Phosphodiesterase 4B in Complex with A Coumarin-Based Inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: PDE4B, COUMARIN, INHIBITOR, HYDROLASE, Metal-binding, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-02-26, released 2010-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07343 (21-End)
      • expression tag (10-20)
    Domains in SCOPe 2.07: d3ly2a1, d3ly2a2
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07343 (21-End)
      • expression tag (10-20)
    Domains in SCOPe 2.07: d3ly2b1, d3ly2b2
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ly2c_
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ly2d_
  • Chain 'E':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ly2e_
  • Chain 'F':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ly2f_
  • Chain 'G':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ly2g_
  • Chain 'H':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ly2h_
  • Heterogens: Z72, ZN, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ly2A (A:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly2A (A:)
    ssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaif
    qerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavft
    dleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehc
    difmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdr
    iqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasve
    ksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ly2B (B:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly2B (B:)
    ssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaif
    qerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavft
    dleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehc
    difmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdr
    iqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasve
    ksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmip
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ly2C (C:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly2C (C:)
    rfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissd
    tfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaih
    dvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtl
    rkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadls
    nptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhpl
    wetwadlvqpdaqdildtlednrnwyqsmipq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ly2D (D:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly2D (D:)
    vntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfi
    tymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvd
    hpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkm
    vidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnpt
    kslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwet
    wadlvqpdaqdildtlednrnwyqsmip
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ly2E (E:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly2E (E:)
    gvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtf
    itymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdv
    dhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrk
    mvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnp
    tkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwe
    twadlvqpdaqdildtlednrnwyqsmip
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ly2F (F:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly2F (F:)
    vntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfi
    tymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvd
    hpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkm
    vidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnpt
    kslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwet
    wadlvqpdaqdildtlednrnwyqsmipq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ly2G (G:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly2G (G:)
    rfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissd
    tfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaih
    dvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtl
    rkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadls
    nptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhpl
    wetwadlvqpdaqdildtlednrnwyqsmipq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ly2H (H:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ly2H (H:)
    rfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissd
    tfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaih
    dvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtl
    rkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadls
    nptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhpl
    wetwadlvqpdaqdildtlednrnwyqsmipq