PDB entry 3lxp

View 3lxp on RCSB PDB site
Description: Structural and Thermodynamic Characterization of the TYK2 and JAK3 Kinase Domains in Complex with CP-690550 and CMP-6
Class: transferase
Keywords: TYK2, JAK3, inflammation, cancer, PAN Inhibitor, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, SH2 domain, Transferase, Tyrosine-protein kinase
Deposited on 2010-02-25, released 2010-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.194
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-receptor tyrosine-protein kinase TYK2
    Species: Homo sapiens [TaxId:9606]
    Gene: TYK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29597 (23-End)
      • engineered (71)
      • engineered (104)
      • engineered (106-107)
      • engineered (277)
    Domains in SCOPe 2.08: d3lxpa_
  • Heterogens: IZA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lxpA (A:)
    mahhhhhhhhhhgalevlfqgpgdptvfhkrylkkirdlgeghfgkvslycydptndgtg
    emvavkalkadagpqhrsgwkqeidilrtlyhehiikykgccedagaaslqlvmeyvplg
    slrdylprhsiglaqlllfaqqicegmaylhaqhyihrdlaarnvlldndrlvkigdfgl
    akavpegheyyrvredgdspvfwyapeclkeykfyyasdvwsfgvtlyellthcdssqsp
    ptkfleligiaqgqmtvlrltellergerlprpdkcpaevyhlmkncweteasfrptfen
    lipilktvhekyqgqaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lxpA (A:)
    dptvfhkrylkkirdlgeghfgkvslycydptntgemvavkalkadagpqhrsgwkqeid
    ilrtlyhehiikykgccedagaaslqlvmeyvplgslrdylprhsiglaqlllfaqqice
    gmaylhaqhyihrdlaarnvlldndrlvkigdfglakavpegheyyrvgdspvfwyapec
    lkeykfyyasdvwsfgvtlyellthcdssqspptkfleligiaqgqmtvlrltellerge
    rlprpdkcpaevyhlmkncweteasfrptfenlipilktvhekyqg