PDB entry 3lxl

View 3lxl on RCSB PDB site
Description: Structural and Thermodynamic Characterization of the TYK2 and JAK3 Kinase Domains in Complex with CP-690550 and CMP-6
Class: transferase
Keywords: TYK2, JAK3, inflammation, cancer, PAN Inhibitor, ATP-binding, Disease mutation, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, SCID, SH2 domain, Transferase, Tyrosine-protein kinase
Deposited on 2010-02-25, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.195
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK3
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52333
      • engineered (250)
    Domains in SCOPe 2.07: d3lxla_
  • Heterogens: IZA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lxlA (A:)
    mghhhhhhaqlyacqdptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkql
    qhsgpdqqrdfqreiqilkalhsdfivkyrgvsygpgrqslrlvmeylpsgclrdflqrh
    rarldasrlllyssqickgmeylgsrrcvhrdlaarnilveseahvkiadfglakllpld
    kdyyvvrepgqspifwyapeslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrm
    mgcerdvpalsrllelleegqrlpappacpaevhelmklcwapspqdrpsfsalgpqldm
    lwsgsrgcethaftahpegkhhslsfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lxlA (A:)
    ptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfqreiq
    ilkalhsdfivkyrgvsygpgrqslrlvmeylpsgclrdflqrhrarldasrlllyssqi
    ckgmeylgsrrcvhrdlaarnilveseahvkiadfglakllpldkdyyvvrepgqspifw
    yapeslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgvpalsrllelleeg
    qrlpappacpaevhelmklcwapspqdrpsfsalgpqldml