PDB entry 3lxi

View 3lxi on RCSB PDB site
Description: Crystal Structure of Camphor-Bound CYP101D1
Class: oxidoreductase
Keywords: Cytochrome P450 fold, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2010-02-25, released 2010-06-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_0514
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3lxia_
  • Chain 'B':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_0514
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3lxib_
  • Heterogens: HEM, CAM, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lxiA (A:)
    mnaqtstatqkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpf
    tgghwiatrgtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkg
    lnlaeirkledqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklg
    llanemtrpsgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkp
    mpddralglvsllllggldtvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrf
    avvsdaryvvsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaq
    gphrcagmhlarlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepqrvs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lxiA (A:)
    qkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatr
    gtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkl
    edqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrp
    sgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralgl
    vsllllggldtvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryv
    vsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmh
    larlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lxiB (B:)
    mnaqtstatqkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpf
    tgghwiatrgtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkg
    lnlaeirkledqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklg
    llanemtrpsgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkp
    mpddralglvsllllggldtvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrf
    avvsdaryvvsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaq
    gphrcagmhlarlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepqrvs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lxiB (B:)
    khrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatrg
    tlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkle
    dqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrps
    gntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralglv
    sllllggldtvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryvv
    sdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmhl
    arlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq