PDB entry 3lxf

View 3lxf on RCSB PDB site
Description: Crystal Structure of [2Fe-2S] Ferredoxin Arx from Novosphingobium aromaticivorans
Class: metal binding protein
Keywords: [2Fe-2S] Ferredoxin, Iron, Iron-sulfur, Metal-binding, METAL BINDING PROTEIN
Deposited on 2010-02-25, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_1477
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lxfa_
  • Chain 'B':
    Compound: ferredoxin
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_1477
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lxfb_
  • Chain 'C':
    Compound: ferredoxin
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_1477
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lxfc_
  • Chain 'D':
    Compound: ferredoxin
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_1477
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lxfd_
  • Chain 'E':
    Compound: ferredoxin
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_1477
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lxfe_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lxfA (A:)
    tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
    palsgdendlldssdhrtphsrlscqitindklegleveiaped
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lxfB (B:)
    tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
    palsgdendlldssdhrtphsrlscqitindklegleveiaped
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lxfC (C:)
    tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
    palsgdendlldssdhrtphsrlscqitindklegleveiaped
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lxfD (D:)
    tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
    palsgdendlldssdhrtphsrlscqitindklegleveiaped
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lxfE (E:)
    tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
    palsgdendlldssdhrtphsrlscqitindklegleveiaped