PDB entry 3lx0

View 3lx0 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS D21N at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, Endonuclease, Metal-binding, Nuclease
Deposited on 2010-02-24, released 2011-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SFAG_02204
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • engineered (20)
      • engineered (43-44)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.06: d3lx0a_
  • Heterogens: THP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3lx0A (A:)
atstkklhkepatlikaidgntvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >3lx0A (A:)
atstkklhkepatlikaidgntvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwse