PDB entry 3lww

View 3lww on RCSB PDB site
Description: Structure of an open and closed conformation of Human Importin Beta bound to the Snurportin1 IBB-domain trapped in the same crystallographic asymmetric unit
Class: protein transport
Keywords: PROTEIN TRANSPORT, HEAT repeat, IBB-domain, Importin beta, Karyopherin, Snurportin
Deposited on 2010-02-24, released 2010-06-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.266
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNB1, NTF97
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3lwwa_
  • Chain 'B':
    Compound: Snurportin-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Importin subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNB1, NTF97
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3lwwc_
  • Chain 'D':
    Compound: Snurportin-1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lwwA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
    envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
    pmihelltegrrsktnkaktlatwatkelrklknqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lwwA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
    envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
    pmihelltegrrsktnkaktlatwatkelrklk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lwwC (C:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
    envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
    pmihelltegrrsktnkaktlatwatkelrklknqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lwwC (C:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsarvasnvcwafsslaeaay
    eaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsakd
    cypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqdalq
    isdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglknya
    eyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdial
    aiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdqen
    vhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvearpm
    ihelltegrrsktnkaktlatwatkelrklk
    

  • Chain 'D':
    No sequence available.