PDB entry 3lwp

View 3lwp on RCSB PDB site
Description: Structure of H/ACA RNP bound to a substrate RNA containing 5BrdU
Class: isomerase/RNA binding protein/RNA
Keywords: H/ACA pseudouridine synthase, Isomerase, tRNA processing, Ribonucleoprotein, Ribosome biogenesis, rRNA processing, Ribosomal protein, RNA-binding, ISOMERASE-RNA BINDING PROTEIN-RNA complex
Deposited on 2010-02-24, released 2010-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pseudouridine synthase Cbf5
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: truB, PF1785
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7LWY0
• Chain 'B':
  Compound: Ribosome biogenesis protein Nop10
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF1141
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U1R4
  Domains in SCOPe 2.08: d3lwpb_
• Chain 'C':
  Compound: 50S ribosomal protein L7Ae
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF1367, rpl7ae
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U160
• Chain 'D':
  Compound: h/aca RNA
  Species: synthetic, synthetic
  
• Chain 'E':
  Compound: 5'-r(*gp*ap*gp*cp*gp*(bru)p*gp*cp*gp*gp*up*up*u)-3
  Species: synthetic, synthetic
  
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3lwpB (B:)
  mrfrirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgigrkek
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3lwpB (B:)
  frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.