PDB entry 3lwo

View 3lwo on RCSB PDB site
Description: Structure of H/ACA RNP bound to a substrate RNA containing 5BrU
Class: isomerase/RNA binding protein/RNA
Keywords: H/ACA pseudouridine synthase, Isomerase, tRNA processing, Ribonucleoprotein, Ribosome biogenesis, rRNA processing, Ribosomal protein, RNA-binding, ISOMERASE-RNA BINDING PROTEIN-RNA complex
Deposited on 2010-02-24, released 2010-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.19
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pseudouridine synthase Cbf5
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: truB, PF1785
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ribosome biogenesis protein Nop10
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1141
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3lwob_
  • Chain 'C':
    Compound: 50S ribosomal protein L7Ae
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1367, rpl7ae
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: h/aca RNA
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: 5'-r(*gp*ap*gp*cp*gp*(5bu)p*gp*cp*gp*gp*up*up*u)-3'
    Species: synthetic, synthetic
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lwoB (B:)
    mrfrirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgigrkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lwoB (B:)
    frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.