PDB entry 3lwk

View 3lwk on RCSB PDB site
Description: Crystal structure of human Beta-crystallin A4 (CRYBA4)
Class: Structural Protein
Keywords: Structural Protein, Beta-crystallin, Structural Genomics Consortium, SGC, Cataract, Disease mutation, Eye lens protein, Microphthalmia, Oxidation, Phosphoprotein
Deposited on 2010-02-24, released 2010-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-crystallin A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYBA4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53673 (2-190)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3lwka1, d3lwka2
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lwkA (A:)
    smsagpwkmvvwdedgfqgrrheftaecpsvlelgfetvrslkvlsgawvgfehagfqgq
    qyilergeypswdawggntaypaerltsfrpaacanhrdsrltifeqenflgkkgelsdd
    ypslqamgwegnevgsfhvhsgawvcsqfpgyrgfqyvlecdhhsgdykhfrewgshapt
    fqvqsirriqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lwkA (A:)
    smsagpwkmvvwdedgfqgrrheftaecpsvlelgfetvrslkvlsgawvgfehagfqgq
    qyilergeypswdawggaerltsfrpaacanhrdsrltifeqenflgkkgelsddypslq
    amgwegnevgsfhvhsgawvcsqfpgyrgfqyvlecdhhsgdykhfrewptfqvqsirri
    qq