PDB entry 3lw2

View 3lw2 on RCSB PDB site
Description: Mouse Plasminogen Activator Inhibitor-1 (PAI-1)
Class: hydrolase inhibitor
Keywords: latent mouse plasminogen activator inhibitor-1 (PAI-1), Glycoprotein, Plasminogen activation, HYDROLASE INHIBITOR
Deposited on 2010-02-23, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasminogen activator inhibitor 1
    Species: Mus musculus [TaxId:10090]
    Gene: Serpine1, Mr1, Pai1, Planh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22777 (Start-378)
      • see remark 999 (229)
    Domains in SCOPe 2.07: d3lw2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lw2A (A:)
    lplreshtahqatdfgvkvfqqvvqaskdrnvvfspygvssvlamlqmttagktrrqiqd
    amgfkvnekgtahalrqlskelmgpwnkneistadaifvqrdlelvqgfmphffklfqtm
    vkqvdfseverarfiindwverhtkgmindllakgavdeltrlvlvnalyfsgqwktpfl
    easthqrlfhksdgstvsvpmmaqsnkfnytefttpdgleydvvelpyqgdtlsmfiaap
    fekdvhlsaltnildaelirqwkgnmtrlprllilpkfsletevdlrgpleklgmpdmfs
    atladftslsdqeqlsvaqalqkvrievnesgtvassstafvisarmaptemvidrsflf
    vvrhnptetilfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lw2A (A:)
    htahqatdfgvkvfqqvvqaskdrnvvfspygvssvlamlqmttagktrrqiqdamgfkv
    nekgtahalrqlskelmgpwnkneistadaifvqrdlelvqgfmphffklfqtmvkqvdf
    severarfiindwverhtkgmindllakgavdeltrlvlvnalyfsgqwktpfleasthq
    rlvsvpmmaqsnkfnytefttpdgleydvvelpyqgdtlsmfiaapfekdvhlsaltnil
    daelirqwkgnmtrlprllilpkfsletevdlrgpleklgmpdmfsatladftslsdqeq
    lsvaqalqkvrievnesgtvassstafvisarmaptemvidrsflfvvrhnptetilfmg
    qvmep