PDB entry 3lvz

View 3lvz on RCSB PDB site
Description: New refinement of the crystal structure of BJP-1, a subclass B3 metallo-beta-lactamase of Bradyrhizobium japonicum
Class: hydrolase
Keywords: class B3 metallo-beta-lactamase, hydrolase, beta-lactam hydrolysis
Deposited on 2010-02-23, released 2011-01-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.165
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Blr6230 protein
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: blr6230, Bradyrhizobium
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3lvza_
  • Chain 'B':
    Compound: Blr6230 protein
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: blr6230, Bradyrhizobium
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3lvzb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lvzA (A:)
    mrrltaalcaltllstgaqaqtikdflavamkkwtapfepfqlidniyyvgtdgiavyvi
    ktsqglilmdtampqstgmikdniaklgfkvadiklilnthahldhtggfaeikketgaq
    lvagerdkplleggyypgdeknedlafpavkvdravkegdrvtlgdttltahatpghspg
    ctswemtvkdgkedrevlffcsgtvalnrlvgqptyagivddyratfakakamkidvllg
    phpevygmqakraemkdgapnpfikpgelvtyatslsedfdkqlakqtaalekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lvzA (A:)
    ikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikd
    niaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdekn
    edlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcs
    gtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnp
    fikpgelvtyatslsedfdkqlakqtaalekk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lvzB (B:)
    mrrltaalcaltllstgaqaqtikdflavamkkwtapfepfqlidniyyvgtdgiavyvi
    ktsqglilmdtampqstgmikdniaklgfkvadiklilnthahldhtggfaeikketgaq
    lvagerdkplleggyypgdeknedlafpavkvdravkegdrvtlgdttltahatpghspg
    ctswemtvkdgkedrevlffcsgtvalnrlvgqptyagivddyratfakakamkidvllg
    phpevygmqakraemkdgapnpfikpgelvtyatslsedfdkqlakqtaalekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lvzB (B:)
    tikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmik
    dniaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdek
    nedlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffc
    sgtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapn
    pfikpgelvtyatslsedfdkqlakqtaalekk