PDB entry 3lvc

View 3lvc on RCSB PDB site
Description: Crystal structure of GFP-like protein aceGFP_G222E (A. coerulescens). Colorless form.
Class: fluorescent protein
Keywords: colorless GFP-like protein, chromophore biosynthesis, FLUORESCENT PROTEIN
Deposited on 2010-02-19, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea coerulescens [TaxId:210840]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6YGZ0 (0-End)
      • engineered (10)
      • engineered (63)
      • engineered (100)
      • engineered (205)
    Domains in SCOPe 2.07: d3lvca_
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Aequorea coerulescens [TaxId:210840]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6YGZ0 (0-End)
      • engineered (10)
      • engineered (63)
      • engineered (100)
      • engineered (205)
    Domains in SCOPe 2.07: d3lvcb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lvcA (A:)
    mskgaelftgivpilielngdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttlsygvqcfsrypdhmkqhdffksampegyiqertiffeddgnyksraevkfegdtlv
    nrieltgtdfkedgnilgnkmeynynahnvyimtdkakngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmiyfefvtaaaithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lvcA (A:)
    mskgaelftgivpilielngdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttlsygvqcfsrypdhmkqhdffksampegyiqertiffeddgnyksraevkfegdtlv
    nrieltgtdfkedgnilgnkmeynynahnvyimtdkakngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmiyfefvtaaai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lvcB (B:)
    mskgaelftgivpilielngdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttlsygvqcfsrypdhmkqhdffksampegyiqertiffeddgnyksraevkfegdtlv
    nrieltgtdfkedgnilgnkmeynynahnvyimtdkakngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmiyfefvtaaaithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lvcB (B:)
    mskgaelftgivpilielngdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttlsygvqcfsrypdhmkqhdffksampegyiqertiffeddgnyksraevkfegdtlv
    nrieltgtdfkedgnilgnkmeynynahnvyimtdkakngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmiyfefvtaaai