PDB entry 3lv8

View 3lv8 on RCSB PDB site
Description: 1.8 Angstrom resolution crystal structure of a thymidylate kinase (tmk) from Vibrio cholerae O1 biovar eltor str. N16961 in complex with TMP, thymidine-5'-diphosphate and ADP
Class: transferase
Keywords: Thymidylate Kinase, Vibrio cholerae, Structural Genomics, Infectious Diseases, Center for Structural Genomics of Infectious Diseases, ATP-binding, Kinase, Nucleotide biosynthesis, Nucleotide-binding, Transferase, CSGID
Deposited on 2010-02-19, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: tmk, VC_2016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lv8a_
  • Heterogens: ADP, TMP, TYD, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lv8A (A:)
    mhhhhhhssgvdlgtenlyfqsnamnakfivieglegagkstaiqvvvetlqqngidhit
    rtrepggtllaeklralvkeehpgeelqditelllvyaarvqlvenvikpalargewvvg
    drhdmssqayqgggrqiapstmqslkqtalgdfkpdltlyldidpklglerargrgeldr
    iekmdisfferarerylelansddsvvmidaaqsieqvtadirralqdwlsqvnrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lv8A (A:)
    nakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpge
    elqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqsl
    kqtalgdfkpdltlyldidpklglereldriekmdisfferarerylelansddsvvmid
    aaqsieqvtadirralqdwlsqvn