PDB entry 3lu1

View 3lu1 on RCSB PDB site
Description: Crystal Structure Analysis of WbgU: a UDP-GalNAc 4-epimerase
Class: isomerase
Keywords: Rossmann fold, epimerase, lipopolysaccharide, glycan, NADH, UDP-GlcNAc, ISOMERASE
Deposited on 2010-02-16, released 2010-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lu1a_
  • Chain 'B':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lu1b_
  • Chain 'C':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lu1c_
  • Chain 'D':
    Compound: WbgU
    Species: Plesiomonas shigelloides [TaxId:703]
    Gene: wbgU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lu1d_
  • Heterogens: NAD, UD2, GLY, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lu1A (A:)
    mgsshhhhhhssglvpagsmdiymsryeeitqqlifspktwlitgvagfigsnllekllk
    lnqvvigldnfstghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhq
    aalgsvprsivdpittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveen
    ignplspyavtkyvneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaam
    lkgddvyingdgetsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyi
    ydelnlihhidklsikyrefrsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvr
    flkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lu1A (A:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lu1B (B:)
    mgsshhhhhhssglvpagsmdiymsryeeitqqlifspktwlitgvagfigsnllekllk
    lnqvvigldnfstghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhq
    aalgsvprsivdpittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveen
    ignplspyavtkyvneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaam
    lkgddvyingdgetsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyi
    ydelnlihhidklsikyrefrsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvr
    flkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lu1B (B:)
    sryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldevkt
    lvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnitgf
    lnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvyar
    tygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyidnv
    iqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrhsq
    advtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lu1C (C:)
    mgsshhhhhhssglvpagsmdiymsryeeitqqlifspktwlitgvagfigsnllekllk
    lnqvvigldnfstghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhq
    aalgsvprsivdpittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveen
    ignplspyavtkyvneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaam
    lkgddvyingdgetsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyi
    ydelnlihhidklsikyrefrsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvr
    flkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lu1C (C:)
    sryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldevkt
    lvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnitgf
    lnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvyar
    tygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyidnv
    iqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrhsq
    advtkaidllkyrpnikireglrlsmpwyvrflk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lu1D (D:)
    mgsshhhhhhssglvpagsmdiymsryeeitqqlifspktwlitgvagfigsnllekllk
    lnqvvigldnfstghqynldevktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhq
    aalgsvprsivdpittnatnitgflnilhaaknaqvqsftyaassstygdhpalpkveen
    ignplspyavtkyvneiyaqvyartygfktiglryfnvfgrrqdpngayaavipkwtaam
    lkgddvyingdgetsrdfcyidnviqmnilsalakdsakdniynvavgdrttlnelsgyi
    ydelnlihhidklsikyrefrsgdvrhsqadvtkaidllkyrpnikireglrlsmpwyvr
    flkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lu1D (D:)
    ymsryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldev
    ktlvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnit
    gflnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvy
    artygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyid
    nviqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrh
    sqadvtkaidllkyrpnikireglrlsmpwyvrflk