PDB entry 3ltl

View 3ltl on RCSB PDB site
Description: Crystal structure of human BIG1 Sec7 domain
Class: signaling protein
Keywords: all alpha, Guanine-nucleotide releasing factor, SIGNALING PROTEIN
Deposited on 2010-02-16, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Brefeldin A-inhibited guanine nucleotide-exchange protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARFGEF1, ARFGEP1, BIG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltla_
  • Chain 'B':
    Compound: Brefeldin A-inhibited guanine nucleotide-exchange protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARFGEF1, ARFGEP1, BIG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ltlb_
  • Heterogens: CA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ltlA (A:)
    mghhhhhhgtqfevlkqqkeiieqgidlfnkkpkrgiqylqeqgmlgttpediaqflhqe
    erldstqvgeflgdndkfnkevmyayvdqhdfsgkdfvsalrmflegfrlpgeaqkidrl
    mekfaarylecnqgqtlfasadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgin
    dskdlpeeylsaiyneiagkkismketketg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ltlA (A:)
    lkqqkeiieqgidlfnkkpkrgiqylqeqgmlgttpediaqflhqeerldstqvgeflgd
    ndkfnkevmyayvdqhdfsgkdfvsalrmflegfrlpgeaqkidrlmekfaarylecnqg
    qtlfasadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgindskdlpeeylsaiy
    neiagkkismk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ltlB (B:)
    mghhhhhhgtqfevlkqqkeiieqgidlfnkkpkrgiqylqeqgmlgttpediaqflhqe
    erldstqvgeflgdndkfnkevmyayvdqhdfsgkdfvsalrmflegfrlpgeaqkidrl
    mekfaarylecnqgqtlfasadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgin
    dskdlpeeylsaiyneiagkkismketketg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ltlB (B:)
    eiieqgidlfnkkpkrgiqylqeqgmlgttpediaqflhqeerldstqvgeflgdndkfn
    kevmyayvdqhdfsgkdfvsalrmflegfrlpgeaqkidrlmekfaarylecnqgqtlfa
    sadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgindskdlpeeylsaiyneiag
    kkismk