PDB entry 3lsy

View 3lsy on RCSB PDB site
Description: Enoyl-ACP Reductase from Plasmodium falciparum (PfENR) in complex with triclosan variant T0
Class: oxidoreductase
Keywords: Triclosan, Triclosan variant, Enoyl-ACP reductase, oxidoreductase, P.falciparum
Deposited on 2010-02-14, released 2010-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-ACP reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lsya_
  • Chain 'B':
    Compound: Enoyl-ACP reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lsyb_
  • Heterogens: NAD, FT0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lsyA (A:)
    nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
    dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
    lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
    gygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntn
    qnknrnrhdvhnimnnsgekeekkisasqnytfidyaieysekyaplrqkllstdigsva
    sfllsresraitgqtiyvdnglnimflpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lsyA (A:)
    nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
    dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
    lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
    gygggmssakaalesdtrvlayhlgrnynirintisagplksraataintfidyaieyse
    kyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lsyB (B:)
    nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
    dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
    lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
    gygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntn
    qnknrnrhdvhnimnnsgekeekkisasqnytfidyaieysekyaplrqkllstdigsva
    sfllsresraitgqtiyvdnglnimflpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lsyB (B:)
    nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
    dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
    lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
    gygggmssakaalesdtrvlayhlgrnynirintisagplksraataintfidyaieyse
    kyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpd