PDB entry 3lsf

View 3lsf on RCSB PDB site
Description: Piracetam bound to the ligand binding domain of GluA2
Class: transport protein
Keywords: glutamate receptor, GluR2, GluA2, AMPA receptor, neurotransmitter receptor, S1S2, allosteric modulator, Alternative splicing, Cell junction, Cell membrane, Endoplasmic reticulum, Glycoprotein, Ion transport, Ionic channel, Membrane, Phosphoprotein, Postsynaptic cell membrane, Receptor, RNA editing, Synapse, Transmembrane, Transport, TRANSPORT PROTEIN
Deposited on 2010-02-12, released 2010-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-113)
      • linker (114-115)
      • engineered (238)
    • Uniprot P19491 (116-257)
      • linker (114-115)
      • engineered (238)
    Domains in SCOPe 2.06: d3lsfb_
  • Chain 'E':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-113)
      • linker (114-115)
      • engineered (238)
    • Uniprot P19491 (116-257)
      • linker (114-115)
      • engineered (238)
    Domains in SCOPe 2.06: d3lsfe_
  • Chain 'H':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (0-113)
      • linker (114-115)
      • engineered (238)
    • Uniprot P19491 (116-257)
      • linker (114-115)
      • engineered (238)
    Domains in SCOPe 2.06: d3lsfh_
  • Heterogens: GLU, PZI, ZN, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lsfB (B:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
    qglldklknkwwydkgec
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lsfE (E:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
    qglldklknkwwydkgec
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lsfH (H:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
    qglldklknkwwydkgec