PDB entry 3ls4

View 3ls4 on RCSB PDB site
Description: Crystal Structure of Anti-tetrahydrocannabinol Fab Fragment in Complex with THC
Class: immune system
Keywords: Immune system, Antibody, Immunoglobulin, Fab fragment, Cannabinoid complex
Deposited on 2010-02-12, released 2010-06-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of antibody Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LS4 (0-218)
  • Chain 'L':
    Compound: Light chain of antibody Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LS4 (0-214)
    Domains in SCOPe 2.04: d3ls4l1, d3ls4l2
  • Heterogens: TCI, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ls4L (L:)
divltqspttmaaspgekititcsasssissnylhwyqqkpgfspklliyrtsnlasgvp
arfsgsgsgtsysltigtmeaedvatyycqqgssipltfgagtklelkradaaptvsifp
psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
tltkdeyerhnsytceathktstspivksfnrnec